PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v4515470.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 290aa    MW: 33051.2 Da    PI: 6.5139
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v4515470.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.43.4e-50101381129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrF P+deelv++yL kkv+++++    ++ e+d++ +ePw+Lp+ +k + +ewyfFs rd+kyatg r+nrat+sgyWkatgkd++v++
  Lj1g3v4515470.1  10 LPPGFRFYPSDEELVCHYLYKKVTNEHVLK-GTLVEIDLHICEPWQLPEVAKLNGNEWYFFSFRDRKYATGFRANRATASGYWKATGKDRTVID 102
                      79***********************99655.78***************8888899**************************************9 PP

              NAM  95 k.kgelvglkktLvfykgrapkgektdWvmheyrle 129
                      + ++e+vg++ktLvfy++rap+g kt W+mhe+rle
  Lj1g3v4515470.1 103 SvTREVVGMRKTLVFYRNRAPNGIKTGWIMHEFRLE 138
                      988999***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.45E-618156IPR003441NAC domain
PROSITE profilePS5100557.2810156IPR003441NAC domain
PfamPF023658.9E-2811137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MGLRDISASL PPGFRFYPSD EELVCHYLYK KVTNEHVLKG TLVEIDLHIC EPWQLPEVAK  60
LNGNEWYFFS FRDRKYATGF RANRATASGY WKATGKDRTV IDSVTREVVG MRKTLVFYRN  120
RAPNGIKTGW IMHEFRLEAP HMPPKEDWVL CRVFHKSKED NSSKFSTQQL MMYNETTSPP  180
PPLTLSSSSP LINQTMPAIG GYNRLPSFSS STPTLHNHFN LNTSSLNLLP FSQETNNSTV  240
TTQLSSKADD GYGFLWDMDM EENNSFEDGV ASNLDAIRFE VDNNNNVVLI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-47915716166NO APICAL MERISTEM PROTEIN
1ut4_B1e-47915716166NO APICAL MERISTEM PROTEIN
1ut7_A1e-47915716166NO APICAL MERISTEM PROTEIN
1ut7_B1e-47915716166NO APICAL MERISTEM PROTEIN
3swm_A1e-47915719169NAC domain-containing protein 19
3swm_B1e-47915719169NAC domain-containing protein 19
3swm_C1e-47915719169NAC domain-containing protein 19
3swm_D1e-47915719169NAC domain-containing protein 19
3swp_A1e-47915719169NAC domain-containing protein 19
3swp_B1e-47915719169NAC domain-containing protein 19
3swp_C1e-47915719169NAC domain-containing protein 19
3swp_D1e-47915719169NAC domain-containing protein 19
4dul_A1e-47915716166NAC domain-containing protein 19
4dul_B1e-47915716166NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004493788.11e-159PREDICTED: NAC domain-containing protein 21/22
SwissprotQ84TE64e-67NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLK7MYQ11e-158K7MYQ1_SOYBN; Uncharacterized protein
STRINGGLYMA19G34881.11e-157(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43813359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.12e-91NAC domain containing protein 74